PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v0647470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YA
Protein Properties Length: 337aa    MW: 36676.6 Da    PI: 6.7083
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v0647470.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.81.6e-32165221158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep+YVNaKQyq+Il+RRq+Rak+e e+kl +ksrkpylheSRh+hA+rR+RgsgGrF
  Lj6g3v0647470.1 165 QEPVYVNAKQYQGILRRRQARAKAELERKL-IKSRKPYLHESRHQHAMRRARGSGGRF 221
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.4E-36163224IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.979164224IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.7E-28166221IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.7E-24167189IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860169189IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.7E-24198221IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MQSKSEAANR LRSDPHSFQP GSVYSEPWWR GVGYNPMAQT MSGANASNSS SEGPNGDSES  60
NDEGQSLSNS GMNEEDDDAT KDSQAADPNQ SGNHGQEQQG VQHATSSAPI PQLELVGHSI  120
ACAPNPYQDP YYGGMMAAYG HQQLGYAPFI GMPHARMPLP LEMAQEPVYV NAKQYQGILR  180
RRQARAKAEL ERKLIKSRKP YLHESRHQHA MRRARGSGGR FAKKTDLDNN SGKEKDNGSG  240
PVLSSQSISS SGSEPLPSDE TWNSPHMQHD ARGSKVGDRF EAANYENGSG SYHNNNGSQS  300
SRYHQPSGER VDEGDCSGQQ RGSVSSNEAS QRRLAIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-19165237266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1339510.0BT133951.1 Lotus japonicus clone JCVI-FLLj-5N11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003551355.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
RefseqXP_014626518.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
SwissprotQ9LXV57e-83NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A0B2REF60.0A0A0B2REF6_GLYSO; Nuclear transcription factor Y subunit A-1
STRINGGLYMA18G07890.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40123461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.43e-79nuclear factor Y, subunit A1